Iright
BRAND / VENDOR: Proteintech

Proteintech, 17939-1-AP, RPE65 Polyclonal antibody

CATALOG NUMBER: 17939-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RPE65 (17939-1-AP) by Proteintech is a Polyclonal antibody targeting RPE65 in WB, IHC, IF-P, IF-Fro, ELISA applications with reactivity to human, mouse, rat samples 17939-1-AP targets RPE65 in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Y79 cells, HeLa cells, PC-3 cells Positive IHC detected in: mouse eye tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse eye tissue Positive IF-Fro detected in: mouse eye tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500 Background Information RPE65(Retinal pigment epithelium-specific 65 kDa protein) is also named as retinoid isomerohydrolase with the calculated molecular weight og 61 kDa and belongs to the carotenoid oxygenase family. It is a microsomal protein with isomerase activity in the retinoid visual cycle that playing a role in the isomerisation of all-trans (vitamin A) to 11-cis retinal, the chromophore of the visual pigments. It also might be involved in retinoid uptake of keratinocytes. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12356 Product name: Recombinant human RPE65 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 204-533 aa of BC075036 Sequence: YNIVKIPPLQADKEDPISKSEIVVQFPCSDRFKPSYVHSFGLTPNYIVFVETPVKINLFKFLSSWSLWGANYMDCFESNETMGVWLHIADKKRKKYLNNKYRTSPFNLFHHINTYEDNGFLIVDLCCWKGFEFVYNYLYLANLRENWEEVKKNARKAPQPEVRRYVLPLNIDKADTGKNLVTLPNTTATAILCSDETIWLEPEVLFSGPRQAFEFPQINYQKYCGKPYTYAYGLGLNHFVPDRLCKLNVKTKETWVWQEPDSYPSEPIFVSHPDALEEDDGVVLSVVVSPGAGQKPAYLLILNAKDLSEVARAEVEINIPVTFHGLFKKS Predict reactive species Full Name: retinal pigment epithelium-specific protein 65kDa Calculated Molecular Weight: 61 kDa Observed Molecular Weight: 65 kDa, 61 kDa GenBank Accession Number: BC075036 Gene Symbol: RPE65 Gene ID (NCBI): 6121 RRID: AB_2285290 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16518 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924