Iright
BRAND / VENDOR: Proteintech

Proteintech, 17962-1-AP, OPCML Polyclonal antibody

CATALOG NUMBER: 17962-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The OPCML (17962-1-AP) by Proteintech is a Polyclonal antibody targeting OPCML in WB, ELISA applications with reactivity to human, mouse, rat samples 17962-1-AP targets OPCML in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse pancreas tissue, rat pancreas tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information OPCML, also called opioid-binding cell adhesion molecule (OBCAM), belongs to the IgLON limbic system-associated membrane protein (LSAMP, OPCML/OBCAM, neurotrimin) family of IgG domain containing glycosylphosphatidylinositol-anchored cell adhesion molecules. Originally isolated from brain, OPCMLis also expressed in stomach, ovary, heart, placenta, testis, kidney, liver, pancreas and colon. OPCML has been identified as a tumour suppressor, which inhibited tumor growth in some cancers including ovarian cancer, lung cancer and prostate cancer (PMID: 19176311; 28407749). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12560 Product name: Recombinant human OPCML protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 27-345 aa of BC074773 Sequence: TGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDDRVTRVAWLNRSTILYAGNDKWSIDPRVIILVNTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQIMNISSDITVNEGSSVTLLCLAIGRPEPTVTWRHLSVKEGQGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPPYISKAKNTGVSVGQKGILSCEASAVPMAEFQWFKEETRLATGLDGMRIENKGRMSTLTFFNVSEKDYGNYTCVATNKLGNTNASITLYGPGAVIDGVNSASRALACLWLSGTLLAHFFIKF Predict reactive species Full Name: opioid binding protein/cell adhesion molecule-like Calculated Molecular Weight: 345 aa, 38 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC074773 Gene Symbol: OPCML Gene ID (NCBI): 4978 RRID: AB_2935445 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14982 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924