Proteintech, 17986-1-AP, HINT2 Polyclonal antibody

Size: 20ul / 150ul The HINT2 (17986-1-AP) by Proteintech is a Polyclonal antibody targeting HINT2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 17986-1-AP targets HINT2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12413 Product name: Recombinant human HINT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-163 aa of BC047737 Sequence: MAAAVVLAAGLRAARRAVAATGVRGGQVRGAAGVTDGNEVAKAQQATPGGAAPTIFSRILDKSLPADILYEDQQCLVFRDVAPQAPVHFLVIPKKPIPRISQAEEEDQQLLGHLLLVAKQTAKAEGLGDGYRLVINDGKLGAQSVYHLHIHVLGGRQLQWPPG Predict reactive species Full Name: histidine triad nucleotide binding protein 2 Calculated Molecular Weight: 163 aa, 17 kDa Observed Molecular Weight: ~17 kDa GenBank Accession Number: BC047737 Gene Symbol: HINT2 Gene ID (NCBI): 84681 RRID: AB_3669287 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BX68 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.