Proteintech, 18047-1-AP, MLN51/CASC3 Polyclonal antibody

Size: 20ul / 150ul The MLN51/CASC3 (18047-1-AP) by Proteintech is a Polyclonal antibody targeting MLN51/CASC3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 18047-1-AP targets MLN51/CASC3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A2780 cells, MCF-7 cells, SKOV-3 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information CASC3(cancer susceptibility candidate 3) is also named as MLN51 and belongs to the CASC3 family. It is induced by CSF2, and is important in the proliferation of RA fibroblast-like synoviocytes in the pathogenesis of rheumatoid arthritis (RA)(PMID:17101062). It is a nucleocytoplasmic protein containing, within its aminoterminal half, a coiled-coil domain followed by two nuclear localization signals (NLSs) responsible for nuclear localization and, in its carboxyl-terminal half, a nuclear export signal(NES) that mediates cytoplasmic retention. It possesses many potential phosphorylation sites and is found to be phosphorylated in both normal and cancer-derived cells.(PMID:17652158). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12694 Product name: Recombinant human CASC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 354-703 aa of BC050526 Sequence: LEQTSVRDPSPEADAPVLGSPEKEEAASEPPAAAPDAAPPPPDRPIEKKSYSRARRTRTKVGDAVKLAEEVPPPPEGLIPAPPVPETTPTPPTKTGTWEAPVDSSTSGLEQDVAQLNIAEQNWSPGQPSFLQPRELRGMPNHIHMGAGPPPQFNRMEEMGVQGGRAKRYSSQRQRPVPEPPAPPVHISIMEGHYYDPLQFQGPIYTHGDSPAPLPPQGMLVQPGMNLPHPGLHPHQTPAPLPNPGLYPPPVSMSPGQPPPQQLLAPTYFSAPGVMNFGNPSYPYAPGALPPPPPPHLYPNTQAPSQVYGGVTYYNPAQQQVQPKPSPPRRTPQPVTIKPPPPEVVSRGSS Predict reactive species Full Name: cancer susceptibility candidate 3 Calculated Molecular Weight: 703 aa, 76 kDa Observed Molecular Weight: 115-120 kDa GenBank Accession Number: BC050526 Gene Symbol: CASC3 Gene ID (NCBI): 22794 RRID: AB_10640534 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15234 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.