Proteintech, 18074-1-AP, G6PC2 Polyclonal antibody

Size: 20ul / 150ul The G6PC2 (18074-1-AP) by Proteintech is a Polyclonal antibody targeting G6PC2 in IHC, IF-P, IP, ELISA applications with reactivity to human, mouse samples 18074-1-AP targets G6PC2 in IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IP detected in: mouse pancreas tissue Positive IHC detected in: mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse pancreas tissue Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information G6PC2, also known as IGRP, is a member of the glucose-6-phosphatase catalytic subunit (G6PC) gene family. G6PC2 catalyzes the hydrolysis of glucose-6-phosphate to glucose and inorganic phosphate within the lumen of the endoplasmic reticulum. G6PC2 is mainly expressed in pancreatic islet β-cells. G6PC2 acts to oppose the action of the beta cell glucose sensor, glucokinase, by creating a futile substrate cycle. (PMID: 37855366, PMID: 32569842, PMID: 37552875) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12764 Product name: Recombinant human G6PC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-151 aa of BC104778 Sequence: MDFLHRNGVLIIQHLQKDYRAYYTFLNFMSNVGDPRNIFFIYFPLCFQFNQTVGTKMIWVAVIGDWLNLIFKWILFGHRPYWWVQETQIYPNHSSPCLEQFPTTCETGPGSPSGHAMGASCVWYVMVTAALSHTVCGMDKFSITLHRLTWS Predict reactive species Full Name: glucose-6-phosphatase, catalytic, 2 Calculated Molecular Weight: 355 aa, 41 kDa Observed Molecular Weight: 38-40 kDa GenBank Accession Number: BC104778 Gene Symbol: G6PC2 Gene ID (NCBI): 57818 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NQR9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.