Iright
BRAND / VENDOR: Proteintech

Proteintech, 18075-1-AP, PCDHA9 Polyclonal antibody

CATALOG NUMBER: 18075-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PCDHA9 (18075-1-AP) by Proteintech is a Polyclonal antibody targeting PCDHA9 in IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 18075-1-AP targets PCDHA9 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse brain tissue, rat cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Protocadherins, which constitute the largest subgroup within the cadherin superfamily, are predominantly expressed in the nervous system and are probably involved in the regulation of neuronal recognition and connectivity (PMID: 17936607; 12231349; 17133224). The protocadherin subfamily can be further subdivided into three groups: the clustered protocadherins, comprising α-, β- and γ-protocadherins; δ-protocadherins; and others, many of which are solitary (PMID: 17133224). PCDHA9 belongs to the α-protocadherin (PCDHA) cluster. A homozygous variant in PCDHA9 has been found in three unrelated Chinese ALS patients, suggesting PCDHA9 as a candidate gene for amyotrophic lateral sclerosis(PMID: 38467605). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12767 Product name: Recombinant human PCDHA9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-401 aa of BC104802 Sequence: QLHYSVPEEAEHGTFVGRIAQDLGLELAELVPRLFQLDSKGRGDLLEVNLQNGILFVNSRIDREELCGRSAECSIHLEVIVDRPLQVFHVDVEVKDINDNPPVFPATQKNLFIAESRPLDSRFPLEGASDADIGENALLTYRLSPNEYFFLDVPTSNQQVKPLGLVLRKLLDREETPELHLLLTATDGGKPELTGTVQLLITVLDNNDNAPVFDRTLYTVKLPENVSIGTLVIHPNASDLDEGLNGDIIYSFSSDVSPDIKSKFHMDPLSGAITVIGHMDFEESRAHKIPVEAVDKGFPPLAGHCTLLVEVVDVNDNAPQLTIKTLSVPVKEDAQLGTVIALISVIDLDADANGQVTCSLTPHVPFKLVSTY Predict reactive species Full Name: protocadherin alpha 9 Calculated Molecular Weight: 950 aa, 102 kDa Observed Molecular Weight: 91 kDa GenBank Accession Number: BC104802 Gene Symbol: PCDHA9 Gene ID (NCBI): 9752 RRID: AB_2878491 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y5H5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924