Proteintech, 18077-1-AP, SLC17A2 Polyclonal antibody

Size: 20ul / 150ul The SLC17A2 (18077-1-AP) by Proteintech is a Polyclonal antibody targeting SLC17A2 in WB, IHC, ELISA applications with reactivity to mouse samples 18077-1-AP targets SLC17A2 in WB, IHC, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse liver tissue, mouse kidney tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12770 Product name: Recombinant human SLC17A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 309-436 aa of BC104822 Sequence: RDSGVLSSLPFIAAASCTILGGQLADFLLSRNLLRLITVRKLFSSLDMQVSSWESQGDLGSSQESSLPLPLDSSSVRILSLVGGMSFSCLLQSTCLAWSFTSRLDKQNFKTGPKRGPLPASEDIKLQT Predict reactive species Full Name: solute carrier family 17 (sodium phosphate), member 2 Calculated Molecular Weight: 436 aa, 47 kDa Observed Molecular Weight: 42-47 kDa GenBank Accession Number: BC104822 Gene Symbol: SLC17A2 Gene ID (NCBI): 10246 RRID: AB_3085552 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00624 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.