Iright
BRAND / VENDOR: Proteintech

Proteintech, 18087-1-AP, MMP26 Polyclonal antibody

CATALOG NUMBER: 18087-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MMP26 (18087-1-AP) by Proteintech is a Polyclonal antibody targeting MMP26 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 18087-1-AP targets MMP26 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SKOV-3 cells, HEK-293 cells, human placenta tissue Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SKOV-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information MMP26(matrix metallopeptidase 26) may hydrolyze collagen type IV, fibronectin, fibrinogen, beta-casein, type I gelatin and alpha-1 proteinase inhibitor.MMP26 is expressed in placenta and uterus and is widely expressed in malignant tumors from different sources as well as in diverse tumor cell lines(PMID: 10987280).The proenzyme without the signal peptide has a calculated molecular mass of 29 kDa and the processed enzyme has a calculated molecular mass of 19 kDa(PMID:15574774).This antibody is specific to MMP26. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12806 Product name: Recombinant human MMP26 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-262 aa of BC101541 Sequence: ADHKGWDFVEGYFHQFFLTKKESPLLTQETQTQLLQQFHRNGTDLLDMQMHALLHQPHCGVPDGSDTSISPGRCKWNKHTLTYRIINYPHDMKPSAVKDSIYNAVSIWSNVTPLIFQQVQNGDADIKVSFWQWAHEDGWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQHLYGEKCSSDIP Predict reactive species Full Name: matrix metallopeptidase 26 Calculated Molecular Weight: 262 aa, 30 kDa Observed Molecular Weight: 19 kDa GenBank Accession Number: BC101541 Gene Symbol: MMP26 Gene ID (NCBI): 56547 RRID: AB_2878495 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NRE1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924