Iright
BRAND / VENDOR: Proteintech

Proteintech, 18093-1-AP, Histone H1.5 Polyclonal antibody

CATALOG NUMBER: 18093-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Histone H1 18093-1-AP targets Histone H1.5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, LnCaP cells Positive IHC detected in: mouse brain tissue, human colon tissue, mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:5000-1:30000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Histones are basic nuclear proteins responsible for nucleosome structure of the chromosomal fiber in eukaryotes. Histone H1.5, also known as Histone Cluster 1 H1 Family Member B (HIST1H1B), is a member of the Histone H1/H5 protein family. Histone H1.5 gene has been found to be frequently mutated in colorectal cancer and follicular lymphomas. HIST1H1B overexpression contributes to tumor aggressiveness. Histone H1.5 expression is upregulated in breast cancer and predicts poor prognosis(PMID: 34746019). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12818 Product name: Recombinant human HIST1H1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-226 aa of BC101581 Sequence: MSETAPAETATPAPVEKSPAKKKATKKAAGAGAAKRKATGPPVSELITKAVAASKERNGLSLAALKKALAAGGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPKAKKAGAAKAKKPAGATPKKAKKAAGAKKAVKKTPKKAKKPAAAGVKKVAKSPKKAKAAAKPKKATKSPAKPKAVKPKAAKPKAAKPKAAKPKAAKAKKAAAKKK Predict reactive species Full Name: histone cluster 1, H1b Calculated Molecular Weight: 226 aa, 23 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC101581 Gene Symbol: HIST1H1B Gene ID (NCBI): 3009 RRID: AB_3085553 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P16401 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924