Proteintech, 18104-1-AP, IL-20 Polyclonal antibody

Size: 20ul / 150ul The IL-20 (18104-1-AP) by Proteintech is a Polyclonal antibody targeting IL-20 in WB, IHC, ELISA applications with reactivity to human samples 18104-1-AP targets IL-20 in WB, IF, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Interleukin-20 (IL-20) is a protein belonging to the IL-10 family of cytokines. IL-20 receptor (IL-20R) and IL-20 are expressed in several normal tissue types, including the lung, skin, and kidney. IL-20 is a cytokine structurally related to interleukin 10. IL-20 is produced by activated keratinocytes and monocytes and transmits an intracellular signal through two distinct cell-surface receptor complexes on keratinocytes and other epithelial cells. IL-20 can stimulate STAT3 activation in keratinocytes. IL-20 regulates proliferation and differentiation of keratinocytes during inflammation, particularly inflammation associated with the skin. In addition, IL-20 also causes cell expansion of multipotential hematopoietic progenitor cells. IL-20 is highly associated with potent inflammatory diseases such as psoriasis, contact hypersensitivity, rheumatoid arthritis, and atherosclerosis. Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12447 Product name: Recombinant human IL-20 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 26-176 aa of BC074949 Sequence: KTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE Predict reactive species Full Name: interleukin 20 Calculated Molecular Weight: 406 aa, 44 kDa GenBank Accession Number: BC074949 Gene Symbol: IL-20 Gene ID (NCBI): 50604 RRID: AB_2878501 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NYY1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.