Proteintech, 18124-1-AP, Synaptotagmin-5 Polyclonal antibody

Size: 20ul / 150ul The Synaptotagmin-5 (18124-1-AP) by Proteintech is a Polyclonal antibody targeting Synaptotagmin-5 in WB, IHC, IF-P, ELISA applications with reactivity to human samples 18124-1-AP targets Synaptotagmin-5 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: BxPC-3 cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis (PMID: 8058779). Synaptotagmin-5 (SYT5) belongs to the synaptotagmin family. Synaptotagmin-5 can function as an exocytosis regulator (PMID: 27793683) and is a protein potentially associated with the pathology of schizophrenia (PMID: 32860155). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12677 Product name: Recombinant human SYT5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 51-386 aa of BC046157 Sequence: YRKSCRRRTGKKSQAQAQVHLQEVKGLGQSYIDKVQPEVEELEPAPSGPGQQVADKHELGQLQYSLDYDFQSGQLLVGILQAMGLAALDLGGSSDPYVRVYLLPDKRRRYETKVHRQTLNPHFGETFAFKVPYVELGGRVLVMAVYDFDRFSRNDAIGEVRVPMSSVDLGRPVQAWRELQAAPREEQEKLGDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKVHLLQGGKKVRKKKTTIKKNTLNPYYNEAFSFEVPCDQVQKVQVELTVLDYDKLGKNEAIGRVAVGAAAGGAGLRHWADMLANPRRPIAQWHSLRPPDRVRLLPAP Predict reactive species Full Name: synaptotagmin V Calculated Molecular Weight: 43 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC046157 Gene Symbol: Synaptotagmin-5 Gene ID (NCBI): 6861 RRID: AB_3669292 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00445 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.