Iright
BRAND / VENDOR: Proteintech

Proteintech, 18130-1-AP, LC8/DYNLL1 Polyclonal antibody

CATALOG NUMBER: 18130-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LC8/DYNLL1 (18130-1-AP) by Proteintech is a Polyclonal antibody targeting LC8/DYNLL1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 18130-1-AP targets LC8/DYNLL1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, Jurkat cells, MCF-7 cells, mouse brain tissue, mouse cerebellum tissue, mouse testis tissue Positive IP detected in: MCF-7 cells Positive IHC detected in: mouse brain tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Positive FC (Intra) detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information LC8 (also known as DYNLL1) is a homodimeric sequence-specific chaperone that promotes the ordered (typically homo-) oligomerization of more than a hundred protein targets. LC8/DYNLL1 has previously been proposed to function as an inhibitor of the NF-κB pathway, based on findings that it can bind directly to the IκBα regulatory region(PMID: 18579519). LC8/DYNLL1 regulates apoptotic activities of BCL2L11 by sequestering it to microtubules. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12710 Product name: Recombinant human LC8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-89 aa of BC100289 Sequence: MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG Predict reactive species Full Name: dynein, light chain, LC8-type 1 Calculated Molecular Weight: 89 aa, 10 kDa Observed Molecular Weight: 8-10 kDa GenBank Accession Number: BC100289 Gene Symbol: DYNLL1 Gene ID (NCBI): 8655 RRID: AB_2923569 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P63167 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924