Iright
BRAND / VENDOR: Proteintech

Proteintech, 18147-1-AP, GYPC Polyclonal antibody

CATALOG NUMBER: 18147-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GYPC (18147-1-AP) by Proteintech is a Polyclonal antibody targeting GYPC in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human samples 18147-1-AP targets GYPC in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human blood Positive IHC detected in: human placenta tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human placenta tissue Positive IF/ICC detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:400-1:1600 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Glycophorin-C, encoded by the GYPC gene, is a minor sialoglycoprotein in human erythrocyte membranes. Glycophorin-C interacts with protein 4.1R (EPB41) and plays an important role in regulating the mechanical stability of red cells. Glycophorin C acts as the receptor for the Plasmodium falciparum erythrocyte binding ligand PfEBP-2 (baebl). Glycophorin-D, also encoded by the GYPC gene, is now known as a variant of Glycophorin-C. This antibody is raised against the full-length protein of human Glycophorin-C. The apparent molecular weight of Glycophorin-C is larger than the calculated molecular weight due to glycosylation. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12825 Product name: Recombinant human GYPC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC106051 Sequence: MWSTRSPNSTAWPLSLEPDPGMASASTTMHTTTIAEPDPGMSGWPDGRMETSTPTIMDIVVIAGVIAAVAIVLVSLLFVMLRYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI Predict reactive species Full Name: glycophorin C (Gerbich blood group) Calculated Molecular Weight: 128 aa, 14 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC106051 Gene Symbol: GYPC Gene ID (NCBI): 2995 RRID: AB_2878508 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P04921 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924