Proteintech, 18151-1-AP, PDE6G/H Polyclonal antibody

Size: 20ul / 150ul The PDE6G/H (18151-1-AP) by Proteintech is a Polyclonal antibody targeting PDE6G/H in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 18151-1-AP targets PDE6G/H in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse eye tissue, rat retina tissue Positive IP detected in: mouse eye tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12847 Product name: Recombinant human PDE6H protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-83 aa of BC093738 Sequence: MSDNTTLPAPASNQGPTTPRKGPPKFKQRQTRQFKSKPPKKGVKGFGDDIPGMEGLGTDITVICPWEAFSHLELHELAQFGII Predict reactive species Full Name: phosphodiesterase 6H, cGMP-specific, cone, gamma Calculated Molecular Weight: 83 aa, 9 kDa Observed Molecular Weight: 9 kDa GenBank Accession Number: BC093738 Gene Symbol: PDE6H Gene ID (NCBI): 5149 RRID: AB_2878509 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13956 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.