Proteintech, 18152-1-AP, RAB9B Polyclonal antibody

Size: 20ul / 150ul The RAB9B (18152-1-AP) by Proteintech is a Polyclonal antibody targeting RAB9B in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 18152-1-AP targets RAB9B in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse brain tissue, HepG2 cells Positive IF/ICC detected in: HeLa cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12848 Product name: Recombinant human RAB9B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-201 aa of BC093756 Sequence: MSGKSLLLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQERFKSLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIYYADVKDPEHFPFVVLGNKVDKEDRQVTTEEAQTWCMENGDYPYLETSAKDDTNVTVAFEEAVRQVLAVEEQLEHCMLGHTIDLNSGSKAGSSCC Predict reactive species Full Name: RAB9B, member RAS oncogene family Calculated Molecular Weight: 201 aa, 23 kDa Observed Molecular Weight: 23-25 kDa GenBank Accession Number: BC093756 Gene Symbol: RAB9B Gene ID (NCBI): 51209 RRID: AB_10642146 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NP90 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.