Iright
BRAND / VENDOR: Proteintech

Proteintech, 18177-1-AP, HEPACAM Polyclonal antibody

CATALOG NUMBER: 18177-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HEPACAM (18177-1-AP) by Proteintech is a Polyclonal antibody targeting HEPACAM in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 18177-1-AP targets HEPACAM in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse liver tissue, rat brain tissue, SK-N-SH cells Positive IP detected in: rat brain tissue Positive IHC detected in: human liver tissue, mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:400 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information HepaCAM (hepatocyte cell adhesion molecule), also known as GlialCAM, is a single-pass type I membrane glycoprotein of 416 amino acids. It displays a typical structure of immunoglobulin (Ig)-like adhesion molecules including two extracellular Ig-like domains, a transmembrane segment, and a cytoplasmic tail. It has been shown that hepaCAM forms a cis-homodimer on the cell surface, and modulates cell-matrix interaction. It is predominantly expressed in the CNS glial cells. Defects in HEPACAM gene are the cause of megalencephalic leukoencephalopathy with subcortical cysts type 2A (MLC2A). HEPACAM has also been suggested as a tumor suppressor gene. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12870 Product name: Recombinant human HEPACAM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 36-242 aa of BC104831 Sequence: ITSPVRLIHGTVGKSALLSVQYSSTSSDRPVVKWQLKRDKPVTVVQSIGTEVIGTLRPDYRDRIRLFENGSLLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTTVLELSEAFTLNCSHENGTKPSYTWLKDGKPLLNDSRMLLSPDQKVLTITRVLMEDDDLYSCVVENPISQGRSLPVKITVYRRSSLY Predict reactive species Full Name: hepatocyte cell adhesion molecule Calculated Molecular Weight: 416 aa, 46 kDa Observed Molecular Weight: 46-72 kDa GenBank Accession Number: BC104831 Gene Symbol: HEPACAM Gene ID (NCBI): 220296 RRID: AB_2279680 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14CZ8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924