Proteintech, 18183-1-AP, CST8 Polyclonal antibody

Size: 20ul / 150ul The CST8 (18183-1-AP) by Proteintech is a Polyclonal antibody targeting CST8 in WB, ELISA applications with reactivity to human samples 18183-1-AP targets CST8 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human testis tissue, DU 145 cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12896 Product name: Recombinant human CST8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC069496 Sequence: MPRCRWLSLILLTIPLALVARKDPKKNETGVLRKLKPVNASNANVKQCLWFAMQEYNKESEDKYVFLVVKTLQAQLQVTNLLEYLIDVEIARSDCRKPLSTNEICAIQENSKLKRKLSCSFLVGALPWNGEFTVMEKKCEDA Predict reactive species Full Name: cystatin 8 (cystatin-related epididymal specific) Calculated Molecular Weight: 142 aa, 16 kDa Observed Molecular Weight: 17-19 kDa, 9 kDa GenBank Accession Number: BC069496 Gene Symbol: CST8 Gene ID (NCBI): 10047 RRID: AB_10596471 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60676 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.