Iright
BRAND / VENDOR: Proteintech

Proteintech, 18264-1-AP, CD177 Polyclonal antibody

CATALOG NUMBER: 18264-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CD177 (18264-1-AP) by Proteintech is a Polyclonal antibody targeting CD177 in WB, ELISA applications with reactivity to human, mouse samples 18264-1-AP targets CD177 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse bone marrow Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information CD177, also known as NB1, HNA-2a or PRV-1, is a glycosylphosphatidylinositol (GPI)-anchored glycoprotein that belongs to the uPAR/CD59/Ly6 snake toxin superfamily (PMID: 17898576). It is expressed exclusively by neutrophils, neutrophilic metamyelocytes, and myelocytes (PMID: 17580308). CD177 interacts with β2 integrin CD11b/CD18 and CD11a/CD18, PECAM-1, and participates in neutrophil activation and transmigration (PMID: 17580308; 21193407). CD177 has been identified as a useful biomarker for myeloproliferative diseases (PMID: 17898576). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13146 Product name: Recombinant human CD177 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 28-416 aa of BC029167 Sequence: TVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLWAPQPPADPGSLRCPVCLSMEGCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPGCNLLNGTQEIGPVGMTENCNRKDFLTCHRGTTIMTHGNLAQEPTDWTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHSAPPGVLVASYTHFCSSDLCNSASSSSVLLNSLPPQAAPVPGDRQCPTCVQPLGTCSSGSPRMTCPRGTTHCYDGYIHLSGGGLSTKMSIQGCVAQPSSFLLNHTRQIGIFSAREKRDVQPPASQHEGGGAEGLESL Predict reactive species Full Name: CD177 molecule Calculated Molecular Weight: 437 aa, 46 kDa Observed Molecular Weight: 100-130 kDa GenBank Accession Number: BC029167 Gene Symbol: CD177 Gene ID (NCBI): 57126 RRID: AB_3085560 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N6Q3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924