Iright
BRAND / VENDOR: Proteintech

Proteintech, 18278-1-AP, LMX1B Polyclonal antibody

CATALOG NUMBER: 18278-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LMX1B (18278-1-AP) by Proteintech is a Polyclonal antibody targeting LMX1B in WB, IF, ELISA applications with reactivity to human, mouse samples 18278-1-AP targets LMX1B in WB, IHC, IF, IP, ChIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells Positive IF detected in: embryonic kidney tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF): IF : 1:20-1:200 Background Information LMX1B, LIM homeodomain factor 1b, functions as a transcription factor, and is essential for the normal development of dorsal limb structures, the glomerular basement membrane, the anterior segment of the eye, and dopaminergic and serotonergic neurons. Lmx1b is a continuously expressed, terminal selector-type factor in 5-HT neurons. It is required for maintenance of central serotonergic neurons (PMID: 17151281, PMID: 14602809). It is expressed in brain, testis, skeletal muscle, and pancreatic islets (PMID: 35417751, PMID: 18512225). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13096 Product name: Recombinant human LMX1B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-372 aa of BC112120 Sequence: MLDGIKMEEHALRPGPATLGVLLGSDCPHPAVCEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSCYFRDRKLYCKQDYQQLFAAKCSGCMEKIAPTEFVMRALECVYHLGCFCCCVCERQLRKGDEFVLKEGQLLCKGDYEKEKDLLSSVSPDESDSVKSEDEDGDMKPAKGQGSQSKGSGDDGKDPRRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKLARRHQQQQEQQNSQRLGQEVLSSRMEGMMASYTPLAPPQQQIVAMEQSPYGSSDPFQQGLTPPQMPGNDSIFHDIDSDTSLTSLSDCFLGSSDVGSLQARVGNPIDRLYSMQSSYFAS Predict reactive species Full Name: LIM homeobox transcription factor 1, beta Calculated Molecular Weight: 372 aa, 42 kDa Observed Molecular Weight: 42-45 kDa GenBank Accession Number: BC112120 Gene Symbol: LMX1B Gene ID (NCBI): 4010 RRID: AB_11232226 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60663 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924