Iright
BRAND / VENDOR: Proteintech

Proteintech, 18279-1-AP, PCDHGA1 Polyclonal antibody

CATALOG NUMBER: 18279-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PCDHGA1 (18279-1-AP) by Proteintech is a Polyclonal antibody targeting PCDHGA1 in WB, ELISA applications with reactivity to human, mouse, rat samples 18279-1-AP targets PCDHGA1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: PC-12 cells, SH-SY5Y cells, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Protocadherins, which constitute the largest subgroup within the cadherin superfamily, are predominantly expressed in the nervous system and are probably involved in the regulation of neuronal recognition and connectivity (PMID: 17936607; 12231349; 17133224). The protocadherin subfamily can be further subdivided into three groups: the clustered protocadherins, comprising α-, β- and γ-protocadherins; δ-protocadherins; and others, many of which are solitary (PMID: 17133224). PCDHGA1 (protocadherin gamma subfamily A1) is a potential calcium-dependent cell-adhesion protein. It may be involved in establishing and maintaining specific neuronal connections in the brain. PCDHGA1 has four glycosylation sites. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13107 Product name: Recombinant human PCDHGA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 33-351 aa of BC112082 Sequence: YSVPEETDKGSFVGNIAKDLGLQPQELADGGVRIVSRGRMPLFALNPRSGSLITARRIDREELCAQSMPCLVSFNILVEDKMKLFPVEVEIIDINDNTPQFQLEELEFKMNEITTPGTRISLPFGQDLDVGMNSLQSYQLSSNPHFSLDVQQGADGPQHPEMVLQSPLDREEEAVHHLILTASDGGEPVRSGTLRIYIQVVDANDNPPAFTQAQYHINVPENVPLGTQLLMVNATDPDEGANGEVTYSFHNVDHRVAQIFRLDSYTGEISNKEPLDFEEYKMYSMEVQAQDGAGLMAKVKVLIKVLDVNDNAPEVTITS Predict reactive species Full Name: protocadherin gamma subfamily A, 1 Calculated Molecular Weight: 823aa,90 kDa; 931aa,101 kDa Observed Molecular Weight: 113 kDa GenBank Accession Number: BC112082 Gene Symbol: PCDHGA1 Gene ID (NCBI): 56114 RRID: AB_3669297 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y5H4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924