Iright
BRAND / VENDOR: Proteintech

Proteintech, 18282-1-AP, CCDC85B Polyclonal antibody

CATALOG NUMBER: 18282-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CCDC85B (18282-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC85B in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 18282-1-AP targets CCDC85B in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse heart tissue, mouse lung tissue Positive IP detected in: mouse heart tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Coiled-coil domain-containing protein 85B (CCDC85B), also named as DIPA, is 202 amino acid protein, which belongs to the CCDC85 family. CCDC85B localizes in the nucleus and cytoplasm. CCDC85B is widely expressed in many tissues and functions as a transcriptional repressor. CCDC85B may inhibit the activity of CTNNB1 in a TP53-dependent manner and thus regulate cell growth. CCDC85B may play a role in adipocyte differentiation. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13129 Product name: Recombinant human CCDC85B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-202 aa of BC008796 Sequence: MEAEAGGLEELTDEEMAALGKEELVRRLRREEAARLAALVQRGRLMQEVNRQLQGHLGEIRELKQLNRRLQAENRELRDLCCFLDSERQRGRRAARQWQLFGTQASRAVREDLGGCWQKLAELEGRQEELLRENLALKELCLALGEEWGPRGGPSGAGGSGAGPAPELALPPCGPRDLGDGSSSTGSVGSPDQLPLACSPDD Predict reactive species Full Name: coiled-coil domain containing 85B Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 24-28 kDa GenBank Accession Number: BC008796 Gene Symbol: CCDC85B Gene ID (NCBI): 11007 RRID: AB_2878527 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15834 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924