Proteintech, 18323-1-AP, DEAF1 Polyclonal antibody

Size: 20ul / 150ul The DEAF1 (18323-1-AP) by Proteintech is a Polyclonal antibody targeting DEAF1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 18323-1-AP targets DEAF1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, BxPC-3 cells, Jurkat cells, SH-SY5Y cells Positive IHC detected in: human kidney tissue, human placenta tissue, human testis tissue, human skin tissue, human brain tissue, human spleen tissue, human lung tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13173 Product name: Recombinant human DEAF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-316 aa of BC053322 Sequence: MEDSDSAAKQLGLAEAAAVAAAAAVAAAAAAAAGGEAEEPVLSRDEDSEEDADSEAERETPRVTAVAVMAAEPGHMDMGAEALPGPDEAAAAAAFAEVTTVTVANVGAAADNVFTTSVANAASISGHVLSGRTALQIGDSLNTEKATLIVVHTDGSIVETTGLKGPAAPLTPGPQSPPTPLAPGQEKGGTKYNWDPSVYDSELPVRCRNISGTLYKNRLGSGGRGRCIKQGENWYSPTEFEAMAGRASSKDWKRSIRYAGRPLQCLIQDGILNPHAASCTCAACCDDMTLSGPVRLFVPYKRRKKENELPTTPVKK Predict reactive species Full Name: deformed epidermal autoregulatory factor 1 (Drosophila) Calculated Molecular Weight: 565 aa, 59 kDa Observed Molecular Weight: 60-63 kDa, 72 kDa GenBank Accession Number: BC053322 Gene Symbol: DEAF1 Gene ID (NCBI): 10522 RRID: AB_2261595 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75398 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.