Iright
BRAND / VENDOR: Proteintech

Proteintech, 18346-1-AP, p35 Polyclonal antibody

CATALOG NUMBER: 18346-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The p35 (18346-1-AP) by Proteintech is a Polyclonal antibody targeting p35 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 18346-1-AP targets p35 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IP detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Cyclin dependent kinase-5 (Cdk5), is an atypical but essential member of the Cdk family of proline-directed serine/threonine kinases. CDK5R1 encodes p35, a specific activator of the serine/threonine kinase CDK5, which plays a central role in neuronal migration and differentiation during central nervous system development. The p35 form of this protein is proteolytically cleaved by calpain, generating a p25 form (PMID: 10830966). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13152 Product name: Recombinant human CDK5R1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 99-307 aa of BC020580 Sequence: AQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR Predict reactive species Full Name: cyclin-dependent kinase 5, regulatory subunit 1 (p35) Calculated Molecular Weight: 34 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC020580 Gene Symbol: CDK5R1 Gene ID (NCBI): 8851 RRID: AB_2878535 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15078 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924