Iright
BRAND / VENDOR: Proteintech

Proteintech, 18347-1-AP, CTNNBIP1 Polyclonal antibody

CATALOG NUMBER: 18347-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CTNNBIP1 (18347-1-AP) by Proteintech is a Polyclonal antibody targeting CTNNBIP1 in IHC, ELISA applications with reactivity to human, mouse samples 18347-1-AP targets CTNNBIP1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13160 Product name: Recombinant human CTNNBIP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-81 aa of BC014300 Sequence: MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ Predict reactive species Full Name: catenin, beta interacting protein 1 Calculated Molecular Weight: 21 kDa GenBank Accession Number: BC014300 Gene Symbol: CTNNBIP1 Gene ID (NCBI): 56998 RRID: AB_3085562 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NSA3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924