Iright
BRAND / VENDOR: Proteintech

Proteintech, 18392-1-AP, FASTKD3 Polyclonal antibody

CATALOG NUMBER: 18392-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FASTKD3 (18392-1-AP) by Proteintech is a Polyclonal antibody targeting FASTKD3 in IF/ICC, ELISA applications with reactivity to human samples 18392-1-AP targets FASTKD3 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: transfected cells, HeLa cells, HepG2 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information FAST kinase domain-containing protein 3(FASTKD3) belongs to FASTKD family.FASTKD3 is an essential component of mitochondrial respiration that may modulate energy balance in cells exposed to adverse conditions by functionally coupling mitochondrial protein synthesis to respiration. The expression of endogenous FASTKD3 is very weak. This antibody detects the c-terminal of FASTKD3. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13083 Product name: Recombinant human FASTKD3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 201-550 aa of BC001295 Sequence: PLIIKLGKYVVRHVPHFTNEELRRVLEAFIYFGHHDTFFTKALEHRVAAVCLTLDPEVVCRVMEYCSRELILSKPILNAVAETFVCQTEKFSPRQISALMEPFGKLNYLPPNASALFRKLENVLFTHFNYFPPKSLLKLLHSCSLNECHPVNFLAKIFKPLFLQRLQGKESHLDTLSRAQLTQLFLASVLECPFYKGPKLLPKYQVKSFLTPCCSLETPVDSQLYRYVKIGLTNLLGARLYFAPKVLTPYCYTIDVEIKLDEEGFVLPSTANEDIHKRIALCIDGPKRFCSNSKHLLGKEAIKQRHLQLLGYQVVQIPYHEIGMLKSRRELVEYLQRKLFSQNTVHWLQE Predict reactive species Full Name: FAST kinase domains 3 Calculated Molecular Weight: 76 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC001295 Gene Symbol: FASTKD3 Gene ID (NCBI): 79072 RRID: AB_2878541 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14CZ7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924