Iright
BRAND / VENDOR: Proteintech

Proteintech, 18410-1-AP, Progranulin/PGRN Polyclonal antibody

CATALOG NUMBER: 18410-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Progranulin/PGRN (18410-1-AP) by Proteintech is a Polyclonal antibody targeting Progranulin/PGRN in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 18410-1-AP targets Progranulin/PGRN in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, A431 cells, HeLa cells, HEK-293 cells, PC-3 cells, human saliva, mouse heart tissue, mouse lung tissue, rat brain tissue, U-937 cells, THP-1 cells, RAW 264.7 cells Positive IHC detected in: human pancreas cancer tissue, human kidney tissue, human lung cancer tissue, human ovary tumor tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information GRN, also known as PGRN or PCDGF, is a cysteine-rich protein of 68.5 kDa that is typically secreted into a highly glycosylated 88 kDa form. PGRN is a unique growth factor that plays an important role in cutaneous wound healing. It has an anti-inflammatory effect and promotes cell proliferation. When PCDGF is degraded to several 6-25 kDa fragments, called granulins (GRNs) by neutrophil proteases, a pro-inflammatory reaction occurs. PGRN is widely expressed, particularly in epithelial cells, immune cells, neurons, and chondrocytes. High levels of PGRN expression have been reported in human cancers, and its expression is closely correlated with the development and metastasis of several cancers. The recent discovery that mutations in the gene encoding for pro-granulin (GRN) cause frontotemporal lobar degeneration (FTLD), and other neurodegenerative diseases leading to dementia, has brought renewed interest in progranulin and its functions in the central nervous system. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13178 Product name: Recombinant human PCDGF,GRN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-363 aa of BC000324 Sequence: MWTLVSWVALTAGLVAGTRCPDGQFCPVACCLDPGGASYSCCRPLLDKWPTTLSRHLGGPCQVDAHCSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRD Predict reactive species Full Name: granulin Calculated Molecular Weight: 64 kDa Observed Molecular Weight: 60-70 kDa GenBank Accession Number: BC000324 Gene Symbol: Granulin Gene ID (NCBI): 2896 RRID: AB_10598161 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P28799 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924