Iright
BRAND / VENDOR: Proteintech

Proteintech, 18414-1-AP, SPATA5L1 Polyclonal antibody

CATALOG NUMBER: 18414-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SPATA5L1 (18414-1-AP) by Proteintech is a Polyclonal antibody targeting SPATA5L1 in WB, ELISA applications with reactivity to human samples 18414-1-AP targets SPATA5L1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, HeLa cells, Jurkat cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information SPATA5L1 (Spermatogenesis-associated protein 5-like protein 1) belongs to the AAA+ATPase protein superfamily. A full-length SPATA5L1 transcript and a short SPATA5L1 variant can be produced in human by alternative splicing. Bi-allelic SPATA5L1 variants lead to a human disease characterized by sensorineural hearing loss with or without a nonprogressive mixed neurodevelopmental phenotype. And immunofluorescence analysis in rat hippocampal neurons demonstrated that SPATA5L1 was located in neuronal and glial cell nuclei, with more prominent expression in neurons (PubMed:34626583). SPATA5L1 also has 3 isoforms. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13269 Product name: Recombinant human SPATA5L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC000981 Sequence: MAPDSDPFPEGPLLKLLPLDARDRGTQRCRLGPAALHALGARLGSAVKISLPDGGSCLCTAWPRRDGADGFVQLDPLCASPGAAVGASRSRRSLSLNRLLLVPCPPLRRVAVWPVLRERAGAPGARNTAAVLEAAQELLRNRPISLGHVVVAPPGAPGLVAALHIVGGTPSPDPAGLVTPRTRVSLGGEPPSEAQPQPEVPLGGLSEAADSLRELLRLPLRYPRALTALGLAVPRGVLLAGPPGVGKTQLVQAVAREAGAELLAVSAPALQGSRPGETEENVRRVFQRARELASRGPSLLFLDEMDALCPQRGSRAPESRVVAQVLTLLDGASGDREVVVVGATNRPDALD Predict reactive species Full Name: spermatogenesis associated 5-like 1 Calculated Molecular Weight: 81 kDa Observed Molecular Weight: 81 kDa GenBank Accession Number: BC000981 Gene Symbol: SPATA5L1 Gene ID (NCBI): 79029 RRID: AB_2918062 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BVQ7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924