Iright
BRAND / VENDOR: Proteintech

Proteintech, 18466-1-AP, PPIF Polyclonal antibody

CATALOG NUMBER: 18466-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PPIF (18466-1-AP) by Proteintech is a Polyclonal antibody targeting PPIF in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 18466-1-AP targets PPIF in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, human heart tissue, rat heart tissue, mouse heart tissue Positive IP detected in: mouse heart tissue Positive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:100-1:400 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information PPIF, also named as Cyclophilin D (CypD), CYP3, PPIase F and Rotamase F, belongs to the cyclophilin-type PPIase family. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. PPIF is a mitochondrial matrix protein involved in the induction of necrotic and apoptotic cell death through the activation of the mitochondrial permeability transition (mPT) pore. This antibody is immunized with full length gene PPIF and absorbed by PPIA. So this antibody is specific to PPIF. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13151 Product name: Recombinant human PPIF-Specific protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-207 aa of BC005020 Sequence: MLALRCGSRWLGLLSVPRSVPLRLPAARACSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS Predict reactive species Full Name: peptidylprolyl isomerase F Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 16~22 kDa GenBank Accession Number: BC005020 Gene Symbol: PPIF Gene ID (NCBI): 10105 RRID: AB_2169273 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P30405 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924