Iright
BRAND / VENDOR: Proteintech

Proteintech, 18476-1-AP, PPP1R14B Polyclonal antibody

CATALOG NUMBER: 18476-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PPP1R14B (18476-1-AP) by Proteintech is a Polyclonal antibody targeting PPP1R14B in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 18476-1-AP targets PPP1R14B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, mouse liver tissue, human heart tissue, mouse skeletal muscle tissue, U2OS cells, A549 cells, PC-3 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13373 Product name: Recombinant human PPP1R14B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-147 aa of BC014522 Sequence: MADSGTAGGAALAAPAPGPGSGGPGPRVYFQSPPGAAGEGPGGADDEGPVRRQGKVTVKYDRKELRKRLNLEEWILEQLTRLYDCQEEEIPELEIDVDELLDMESDDARAARVKELLVDCYKPTEAFISGLLDKIRGMQKLSTPQKK Predict reactive species Full Name: protein phosphatase 1, regulatory (inhibitor) subunit 14B Calculated Molecular Weight: 147 aa, 16 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC014522 Gene Symbol: PPP1R14B Gene ID (NCBI): 26472 RRID: AB_10598019 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96C90 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924