Iright
BRAND / VENDOR: Proteintech

Proteintech, 18571-1-AP, QPCT Polyclonal antibody

CATALOG NUMBER: 18571-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The QPCT (18571-1-AP) by Proteintech is a Polyclonal antibody targeting QPCT in WB, IF/ICC, ELISA applications with reactivity to human samples 18571-1-AP targets QPCT in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Caki-2 cells, human urine sample Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Glutaminyl-peptide cyclotransferase (QPCT) gene encodes glutaminyl cyclase (QC), an enzyme that plays a role in post-translational modification of proteins by converting N-terminal glutamate to pyroglutamine. QPCT plays a specific role in promoting tumor cell proliferation, migration and angiogenesis as well as in inhibiting tumor cell apoptosis in cancers such as thyroid cancer and renal cell carcinoma (PMID: 38417050). Human QPCT has two isoforms produced by alternative splicing, 41 kDa and 35 kDa, respectively. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13416 Product name: Recombinant human QPCT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-361 aa of BC047756 Sequence: MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL Predict reactive species Full Name: glutaminyl-peptide cyclotransferase Calculated Molecular Weight: 361 aa, 41 kDa Observed Molecular Weight: 41 kDa, 35 kDa GenBank Accession Number: BC047756 Gene Symbol: QPCT Gene ID (NCBI): 25797 RRID: AB_3669301 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16769 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924