Iright
BRAND / VENDOR: Proteintech

Proteintech, 18642-1-AP, CD23 Polyclonal antibody

CATALOG NUMBER: 18642-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CD23 (18642-1-AP) by Proteintech is a Polyclonal antibody targeting CD23 in WB, IHC, ELISA applications with reactivity to human samples 18642-1-AP targets CD23 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Raji cells Positive IHC detected in: human tonsillitis tissue, human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:800-1:3200 Background Information CD23, also known as low affinity immunoglobulin epsilon Fc receptor, is a transmembrane glycoprotein present on a subpopulation of B lymphocytes in germinal centres, EBV-transformed B-lymphoblastoid cell lines, follicular dendritic cells, and a subpopulation of peripheral blood cells. CD23 has essential roles in the regulation of IgE production and in the differentiation of B-cells. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13348 Product name: Recombinant human FCER2,CD23 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-321 aa of BC014108 Sequence: MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS Predict reactive species Full Name: Fc fragment of IgE, low affinity II, receptor for (CD23) Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 38-42 kDa GenBank Accession Number: BC014108 Gene Symbol: CD23 Gene ID (NCBI): 2208 RRID: AB_2878555 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P06734 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924