Iright
BRAND / VENDOR: Proteintech

Proteintech, 18902-1-AP, SOX13 Polyclonal antibody

CATALOG NUMBER: 18902-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SOX13 (18902-1-AP) by Proteintech is a Polyclonal antibody targeting SOX13 in WB, IP, ELISA applications with reactivity to human samples 18902-1-AP targets SOX13 in WB, IHC, IF, IP, chIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: BGC-823 cells, NCI-H1299 cells Positive IP detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information SRY-BOX 13(SOX13), identified a sequence homologous more than 60% to the SRY HMG box ,with a centrally located HMG box and an N-terminal leucine zipper motif with a neighboring glutamine stretch called a Q box. SOX13 binds to the consensus HMG-box motif. It's an IDDM-specific human autoantigen, and a gamma-delta-specific gene in the immune system. It can modulates Wnt/TCF activity. This is a rabbit polyclonal raised against part of N-terminal chain of SOX13 of human origin. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13537 Product name: Recombinant human SOX13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-301 aa of BC106038 Sequence: MSMRSPISAQLALDGVGTMVNCTIKSEEKKEPCHEAPQGSATAAEPQPGDPARASQDSADPQAPAQGNFRGSWDCSSPEGNGSPEPKRPGVSEAASGSQEKLDFNRNLKEVVPAIEKLLSSDWKERFLGRNSMEAKDVKGTQESLAEKELQLLVMIHQLSTLRDQLLTAHSEQKNMAAMLFEKQQQQMELARQQQEQIAKQQQQLIQQQHKINLLQQQIQQVNMPYVMIPAFPPSHQPLPVTPDSQLALPIQPIPCKPVEYPLQLLHSPPAPVVKRPGAMATHHPLQEPSQPLNLTAKPKA Predict reactive species Full Name: SRY (sex determining region Y)-box 13 Calculated Molecular Weight: 622 aa, 69 kDa Observed Molecular Weight: 69 kDa GenBank Accession Number: BC106038 Gene Symbol: SOX13 Gene ID (NCBI): 9580 RRID: AB_10642149 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UN79 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924