Iright
BRAND / VENDOR: Proteintech

Proteintech, 18970-1-AP, SLC12A1/NKCC2 Polyclonal antibody

CATALOG NUMBER: 18970-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLC12A1/NKCC2 (18970-1-AP) by Proteintech is a Polyclonal antibody targeting SLC12A1/NKCC2 in WB, IHC, IF, ELISA applications with reactivity to human, mouse, rat samples 18970-1-AP targets SLC12A1/NKCC2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, 37°C incubated mouse kidney tissue Positive IHC detected in: human kidney tissue, mouse kidney tissue, rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF detected in: mouse Embryonic kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF): IF : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5325 Product name: Recombinant human SLC12A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-176 aa of BC040138 Sequence: MSLNNSSNVFLDSVPSNTNRFQVSVINENHESSAAADDNTDPPHYEETSFGDEAQKRLRISFRPGNQECYDNFLQSGETAKTDASFHAYDSHTNTYYLQTFGHNTMDAVPKIEYYRNTGSISGPKVNRPSLLEIHEQLAKNVAVTPSSADRVANGDGIPGDEQAENKEDDQAGVVK Predict reactive species Full Name: solute carrier family 12 (sodium/potassium/chloride transporters), member 1 Calculated Molecular Weight: 121 kDa Observed Molecular Weight: 135 kDa GenBank Accession Number: BC040138 Gene Symbol: SLC12A1/NKCC2 Gene ID (NCBI): 6557 RRID: AB_2877130 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13621 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924