Proteintech, 18971-1-AP, TULP1 Polyclonal antibody

Size: 20ul / 150ul The TULP1 (18971-1-AP) by Proteintech is a Polyclonal antibody targeting TULP1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 18971-1-AP targets TULP1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Y79 cells, human brain tissue, mouse retina tissue Positive IHC detected in: human eye tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information TULP1, also known as RP14, LCA15, and TUBL1, is a member of the tubby-like protein (TULP) family. TULP1 is expressed exclusively in the retina and is essential for the transport of rhodopsin from its site of synthesis in the inner segments through the connecting cilium to the outer segments(PMID: 17620573). Mutations in TULP1 are associated with Retinitis pigmentosa 14 and Leber congenital amaurosis-15(PMID: 17620573, 17962469). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5598 Product name: Recombinant human TULP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 139-489 aa of BC032714 Sequence: TKMRKTKKKGSGEADKDPSGSPASARKSPAAMFLVGEGSPDKKALKKKGTPKGARKEEEEEEEAATVIKNSNQKGKAKGKGKKKAKEERAPSPPVEVDEPREFVLRPAPQGRTVRCRLTRDKKGMDRGMYPSYFLHLDTEKKVFLLAGRKRKRSKTANYLISIDPTNLSRGGENFIGKLRSNLLGNRFTVFDNGQNPQRGYSTNVASLRQELAAVIYETNVLGFRGPRRMTVIIPGMSAENERVPIRPRNASDGLLVRWQNKTLESLIELHNKPPVWNDDSGSYTLNFQGRVTQASVKNFQIVHADDPDYIVLQFGRVAEDAFTLDYRYPLCALQAFAIALSSFDGKLACE Predict reactive species Full Name: tubby like protein 1 Calculated Molecular Weight: 489 aa, 55 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC032714 Gene Symbol: TULP1 Gene ID (NCBI): 7287 RRID: AB_2211412 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00294 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.