Iright
BRAND / VENDOR: Proteintech

Proteintech, 19028-1-AP, KLC1 Polyclonal antibody

CATALOG NUMBER: 19028-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KLC1 (19028-1-AP) by Proteintech is a Polyclonal antibody targeting KLC1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 19028-1-AP targets KLC1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, COLO 320 cells, HepG2 cells, mouse brain tissue, SK-N-SH cells Positive IHC detected in: rat brain tissue, human bowen disease tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport. Kinesin is tetrameric proteins containing two heavy (alpha) chains and two light (beta) chains. The alpha chains provide the tubulin binding site and the ATPase domains, whereas the beta chains are responsible for the specific attachment of the organelle to be moved by the kinesin tetramer (PubMed:21385839). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13570 Product name: Recombinant human KLC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-290 aa of BC008881 Sequence: MYDNMSTMVYIKEDKLEKLTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDDESNLVEEKSNMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKDTDSTKEPLDDLFPNDEDDPGQGIQQQHSSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLG Predict reactive species Full Name: kinesin light chain 1 Calculated Molecular Weight: 65 kDa Observed Molecular Weight: 61-70 kDa GenBank Accession Number: BC008881 Gene Symbol: KLC1 Gene ID (NCBI): 3831 RRID: AB_10641041 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q07866 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924