Iright
BRAND / VENDOR: Proteintech

Proteintech, 19070-1-AP, CREBZF Polyclonal antibody

CATALOG NUMBER: 19070-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CREBZF (19070-1-AP) by Proteintech is a Polyclonal antibody targeting CREBZF in WB, ELISA applications with reactivity to mouse samples 19070-1-AP targets CREBZF in WB, IF, IHC, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse kidney tissue, mouse liver tissue, mouse ovary tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information CREBZF is a basic region-leucine zipper (bZIP) transcription factor that belongs to the cAMP-response-element-binding protein (CREB)/activating transcription factor (ATF) family. CREBZF gene expression produces two isoforms, CREBZF-L (long isoform of CREBZF, also known as SMILE) and CREBZF-S (short isoform of CREBZF, also known as Zhangfei), resulting from alternative initiation codons. CREBZF fulfills its role in transcriptional regulation by heterodimerizing with other transcription factors as a coregulator and then binding to target promoters and regulating downstream gene expression. CREBZF has been identified as a novel transcriptional coregulator of a variety of nuclear receptors (PMID: 31124138). Specification Tested Reactivity: mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13625 Product name: Recombinant human CREBZF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 185-301 aa of BC093796 Sequence: GLAAENQELRAENRELGKRVQALQEESRYLRAVLANETGLARLLSRLSGVGLRLTTSLFRDSPAGDHDYALPVGKQKQDLLEEDDSAGGVCLHVDKDKVSVEFCSACARKASSSLKM Predict reactive species Full Name: CREB/ATF bZIP transcription factor Calculated Molecular Weight: 272 aa, 30 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC093796 Gene Symbol: CREBZF Gene ID (NCBI): 58487 RRID: AB_10641036 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NS37 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924