Proteintech, 19363-1-AP, SLC25A20 Polyclonal antibody

Size: 20ul / 150ul The SLC25A20 (19363-1-AP) by Proteintech is a Polyclonal antibody targeting SLC25A20 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 19363-1-AP targets SLC25A20 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Saos-2 cells, mouse heart tissue, human testis tissue, mouse skeletal muscle tissue, mouse testis tissue, rat testis tissue Positive IHC detected in: mouse heart tissue, human heart tissue, human hepatocirrhosis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Hela cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6896 Product name: Recombinant human SLC25A20 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 96-209 aa of BC001689 Sequence: GKKLQQKHPEDVLSYPQLFAAGMLSGVFTTGIMTPGERIKCLLQIQASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSA Predict reactive species Full Name: solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC001689 Gene Symbol: SLC25A20 Gene ID (NCBI): 788 RRID: AB_10642001 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43772 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.