Iright
BRAND / VENDOR: Proteintech

Proteintech, 19422-1-AP, FAM103A1 Polyclonal antibody

CATALOG NUMBER: 19422-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FAM103A1 (19422-1-AP) by Proteintech is a Polyclonal antibody targeting FAM103A1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 19422-1-AP targets FAM103A1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, MCF-7 cells, PC-3 cells Positive IHC detected in: mouse lung tissue, human oesophagus cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information FAM103A1, also named as RNMT-activating mini protein, is a 118 amino acid protein, which belongs to the RAM family. FAM103A1 as a component of mRNA cap binding complex localizes in the nucleus. FAM103A1 is required for efficient mRNA cap methylation and regulates RNMT expression by a post-transcriptional stabilizing mechanism. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13749 Product name: Recombinant human FAM103A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC003627 Sequence: MTDTAEAVPKFEEMFASRFTENDKEYQEYLKRPPESPPIVEEWNSRAGGNQRNRGNRLQDNRQFRGRDNRWGWPSDNRSNQWHGRSWGNNYPQHRQEPYYPQQYGHYGYNQRPPYGYY Predict reactive species Full Name: family with sequence similarity 103, member A1 Calculated Molecular Weight: 118 aa, 14 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: BC003627 Gene Symbol: FAM103A1 Gene ID (NCBI): 83640 RRID: AB_2878578 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BTL3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924