Proteintech, 19425-1-AP, COX16 Polyclonal antibody

Size: 20ul / 150ul The COX16 (19425-1-AP) by Proteintech is a Polyclonal antibody targeting COX16 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 19425-1-AP targets COX16 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, SH-SY5Y cells Positive IHC detected in: human stomach tissue, human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13756 Product name: Recombinant human COX16 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-106 aa of BC001702 Sequence: MFAPAVMRAFRKNKTLGYGVPMLLLIVGGSFGLREFSQIRYDAVKSKMDPELEKKLKENKISLESEYEKIKDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKTT Predict reactive species Full Name: COX16 cytochrome c oxidase assembly homolog (S. cerevisiae) Calculated Molecular Weight: 106 aa, 12 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: BC001702 Gene Symbol: COX16 Gene ID (NCBI): 51241 RRID: AB_10666854 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9P0S2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.