Proteintech, 19426-1-AP, ZNF593 Polyclonal antibody

Size: 20ul / 150ul The ZNF593 (19426-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF593 in WB, ELISA applications with reactivity to human, mouse samples 19426-1-AP targets ZNF593 in WB, IF, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse spleen tissue, PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13758 Product name: Recombinant human ZNF593 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-134 aa of BC002580 Sequence: MGRSRRTGAHRAHSLARQMKAKRRRPDLDEIHRELRPQGSARPQPDPNAEFDPDLPGGGLHRCLACARYFIDSTNLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYVPPRRLAVPTEVSTEVPEMDTST Predict reactive species Full Name: zinc finger protein 593 Calculated Molecular Weight: 134 aa, 15 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC002580 Gene Symbol: ZNF593 Gene ID (NCBI): 51042 RRID: AB_10642948 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00488 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.