Iright
BRAND / VENDOR: Proteintech

Proteintech, 19428-1-AP, SEZ6L2 Polyclonal antibody

CATALOG NUMBER: 19428-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SEZ6L2 (19428-1-AP) by Proteintech is a Polyclonal antibody targeting SEZ6L2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 19428-1-AP targets SEZ6L2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information Seizure 6-like protein 2 (SEZ6L2) is a type 1 transmembrane protein predominantly expressed in the brain. It belongs to the seizure-related gene 6 (SEZ6) family, which contains SEZ6, SEZ6L and SEZ6L2. SEZ6 family members have been shown to influence synapse numbers and dendritic morphology and are linked to various neurological and psychiatric disorders (PMID: 33936031). SEZ6L2 is a part of the AMPA receptor and acts as a scaffolding protein to link GluR1 to adducin (PMID: 29032200). Overexpression of SEZ6L2 has been reported in a variety of cancers, including lung cancer, hepatocellular carcinoma, thyroid carcinoma, cholangiocarcinoma (PMID: 16863507; 35117286; 35284305; 32148567). SEZ6L2 can be glycosylated and the apparent molecular weight can be raised to 150-170 kDa (PMID: 26698217; 24272587). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13760 Product name: Recombinant human SEZ6L2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 280-626 aa of BC000567 Sequence: RVSLDEDNDRLMVRSGGSPLSPVIYDSDMDDVPERGLISDAQSLYVELLSETPANPLLLSLRFEAFEEDRCFAPFLAHGNVTTTDPEYRPGALATFSCLPGYALEPPGPPNAIECVDPTEPHWNDTEPACKAMCGGELSEPAGVVLSPDWPQSYSPGQDCVWGVHVQEEKRILLQVEILNVREGDMLTLFDGDGPSARVLAQLRGPQPRRRLLSSGPDLTLQFQAPPGPPNPGLGQGFVLHFKEVPRNDTCPELPPPEWGWRTASHGDLIRGTVLTYQCEPGYELLGSDILTCQWDLSWSAAPPACQKIMTCADPGEIANGHRTASDAGFPVGSHVQYRCLPGYSLE Predict reactive species Full Name: seizure related 6 homolog (mouse)-like 2 Calculated Molecular Weight: 910 aa, 98 kDa Observed Molecular Weight: 150 kDa GenBank Accession Number: BC000567 Gene Symbol: SEZ6L2 Gene ID (NCBI): 26470 RRID: AB_3085577 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6UXD5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924