Iright
BRAND / VENDOR: Proteintech

Proteintech, 19429-1-AP, ZIP7 Polyclonal antibody

CATALOG NUMBER: 19429-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZIP7 (19429-1-AP) by Proteintech is a Polyclonal antibody targeting ZIP7 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 19429-1-AP targets ZIP7 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, HeLa cells Positive IP detected in: mouse brain tissue Positive IHC detected in: human kidney tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ZIP7 is a functional zinc transporter transporting zinc from the Golgi apparatus to the cytoplasm of the cell. ZIP7 is post-translationally regulated by CK2-mediated phosphorylation. This ZIP7 phosphorylation results in zinc release from intracellular stores, which activates multiple tyrosine kinases and regulate cell survival and proliferation. Dual bands of 50 kDa and 56 kDa detected by this antibody may represent the native and phosphorylated forms of ZIP7, respectively. (PMID: 28232492, 28205653) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13762 Product name: Recombinant human SLC39A7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 237-384 aa of BC000645 Sequence: VRHVKGGHGHSHGHGHAHSHTRGSHGHGRQERSTKEKQSSEEEEKETRGVQKRRGGSTVPKDGPVRPQNAEEEKRGLDLRVSGYLNLAADLAHNFTDGLAIGASFRGGRGLGILTTMTVLLHEVPHEVGDFAILVQSGCSKKQAMRLQ Predict reactive species Full Name: solute carrier family 39 (zinc transporter), member 7 Calculated Molecular Weight: 469 aa, 50 kDa Observed Molecular Weight: 45-50 kDa, 56 kDa GenBank Accession Number: BC000645 Gene Symbol: ZIP7 Gene ID (NCBI): 7922 RRID: AB_10643376 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92504 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924