Iright
BRAND / VENDOR: Proteintech

Proteintech, 19430-1-AP, HUWE1 Polyclonal antibody

CATALOG NUMBER: 19430-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HUWE1 (19430-1-AP) by Proteintech is a Polyclonal antibody targeting HUWE1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 19430-1-AP targets HUWE1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Daudi cells, HEK-293 cells Positive IHC detected in: human lung cancer tissue, human lung tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information HUWE1 encodes a HECT domain ubiquitin ligase which is a large protein (500 kDa) has attracted considerable interest because several and quite disparate substrates have been assigned to this E3. It has a role in regulating Berg-mann glia differentiation and this ubiquitin ligase orchestrates the programming of the neural progenitors that give rise to neurons and glia in the cerebellum. HUWE1 is essential for proliferation of a subset of tumor cells, and negative regulator of TP53 during the colorectal carcinoma progression through the ubiquitination pathway mediated by the HECT domain (PMID:15567145). HUWE1 plays a critical role in lung cancer and increased HUWE1 expression is significantly associated with worse prognosis which suggest that HUWE1 might be a potential target for lung cancer therapy (PMID: 30026863). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13763 Product name: Recombinant human HUWE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 3983-4374 aa of BC002602 Sequence: AVLVDYIRVLDFDVKRKYFRQELERLDEGLRKEDMAVHVLRDHVFEDSYRELHRKSPEEMKNRLYIVFEGEEGQDAGGLLREWYMIISREMFNPMYALFRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRIVAKAVYDNRLLECYFTRSFYKHILGKSVRYTDMESEDYHFYQGLVYLLENDVSTLGYDLTFSTEVQEFGVCEVRDLKPNGANILVTEENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPTIDIDDLKSNTEYHKYQSNSIQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESFEKLRHMLLLAIQECSEGFGLA Predict reactive species Full Name: HECT, UBA and WWE domain containing 1 Calculated Molecular Weight: 437 aa, 482 kDa Observed Molecular Weight: 482 kDa-550 kDa GenBank Accession Number: BC002602 Gene Symbol: HUWE1 Gene ID (NCBI): 10075 RRID: AB_2878579 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z6Z7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924