Proteintech, 19902-1-AP, GULP1 Polyclonal antibody

Size: 20ul / 150ul The GULP1 (19902-1-AP) by Proteintech is a Polyclonal antibody targeting GULP1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 19902-1-AP targets GULP1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, NIH/3T3 cells, HepG2 cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13829 Product name: Recombinant human GULP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-133 aa of BC001103 Sequence: MNRAFSRKKDKTWMHTPEALSKHFIPYNAKFLGSTEVEQPKGTEVVRDAVRKLKFARHIKKSEGQKIPKVELQISIYGVKILEPKTKEVQHNCQLHRISFCADDKTDKRIFTFICKDSESNKHLCYVFDSEKC Predict reactive species Full Name: GULP, engulfment adaptor PTB domain containing 1 Calculated Molecular Weight: 167 aa, 19 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC001103 Gene Symbol: GULP1 Gene ID (NCBI): 51454 RRID: AB_10916254 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UBP9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.