Iright
BRAND / VENDOR: Proteintech

Proteintech, 19910-1-AP, DDX17 Polyclonal antibody

CATALOG NUMBER: 19910-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DDX17 (19910-1-AP) by Proteintech is a Polyclonal antibody targeting DDX17 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 19910-1-AP targets DDX17 in WB, IHC, IF/ICC, IP, CoIP, chIP, ELISA, PLA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, HEK-293T cells, HEK-293 cells, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information DDX17, also named as DEAD box protein p72 and DEAD box protein p82, is a 729 amino acid protein, which belongs to the DEAD box helicase family. DDX5/DBP2 subfamily. DDX17 is widely expressed. Levels tend to increase during colon cancer progression, from very low in benign hyperplastic polyps to very high in tubular and villous adenomas. DDX17 as an RNA helicase unwinds RNA and alters RNA structures through ATP binding and hydrolysis. DDX17 is involved in multiple cellular processes, including pre-mRNA splicing, alternative splicing, ribosomal RNA processing and miRNA processing, as well as transcription regulation. It Regulates the alternative splicing of exons exhibiting specific features. identification and characterisation of p72, a novel human nuclear DEAD box protein, which shows a striking homology to p68. This antibody could detect the 72 kDa isoform and 80 kDa isoform of DDX17. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13723 Product name: Recombinant human DDX17,P72 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 381-729 aa of BC000595 Sequence: NLELSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQLVDHRGGGGGGGGRSRYRTTSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGYGSPNSAFGAQAGQYTYGQGTYGAAAYGTSSYTAQEYGAGTYGASSTTSTGRSSQSSSQQFSGIGRSGQQPQPLMSQQFAQPPGATNMIGYMGQTAYQYPPPPPPPPPSRK Predict reactive species Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 Calculated Molecular Weight: 729 aa, 80 kDa Observed Molecular Weight: 72-80 kDa GenBank Accession Number: BC000595 Gene Symbol: DDX17 Gene ID (NCBI): 10521 RRID: AB_10667004 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92841 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924