Iright
BRAND / VENDOR: Proteintech

Proteintech, 19915-1-AP, KDM3B Polyclonal antibody

CATALOG NUMBER: 19915-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KDM3B (19915-1-AP) by Proteintech is a Polyclonal antibody targeting KDM3B in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 19915-1-AP targets KDM3B in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, human placenta tissue, HeLa cells, HepG2 cells Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13795 Product name: Recombinant human KDM3B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1127-1382 aa of BC001202 Sequence: SRQNKSVLRPAVTNGMSQLPSINPSASSGNETTFSGGGGPAPVTTPEPDHVPKADSTDIRSEEPLKTDSSASNSNSELKAIRPPCPDTAPPSSALHWLADLATQKAKEETKEAGSLRSVLNKESHSPFGLDSFNSTAKVSPLTPKLFNSLLLGPTASNNKTEGSSLRDLLHSGPGKLPQTPLDTGIPFPPVFSTSSAGVKSKASLPNFLDHIIASVVENKKTSDASKRACNLTDTQKEVKEMVMGLNVLDPHTSHS Predict reactive species Full Name: lysine (K)-specific demethylase 3B Calculated Molecular Weight: 1761 aa, 192 kDa Observed Molecular Weight: 192 kDa, 85 kDa GenBank Accession Number: BC001202 Gene Symbol: KDM3B Gene ID (NCBI): 51780 RRID: AB_10693529 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7LBC6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924