Proteintech, 19925-1-AP, TMEM175 Polyclonal antibody

Size: 20ul / 150ul The TMEM175 (19925-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM175 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 19925-1-AP targets TMEM175 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, SH-SY5Y cells, HepG2 cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TMEM175 has two repeats of 6-transmembrane-spanning segments and has no GYG K+ channel sequence signature-containing, pore-forming P loop. Lysosomes lacking TMEM175 exhibit no K+conductance, have a markedly depolarized ΔΨ and little sensitivity to changes in [K+], and have compromised luminal pH stability and abnormal fusion with autophagosomes during autophagy. TMEM175 comprises a K+ channel that underlies the molecular mechanism of lysosomal K+ permeability. It has two isoforms with MW 41-45 kDa and 54-60 kDa. For optimal WB detection with this antibody, we recommend avoiding boiling the sample after lysis. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13890 Product name: Recombinant human TMEM175 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 222-313 aa of BC005158 Sequence: YVSKVTGWCRDRLLGHREPSAHPVEVFSFDLHEPLSKERVEAFSDGVYAIVATLLILDICEDNVPDPKDVKERFSGSLVAALSATGPRFLAY Predict reactive species Full Name: transmembrane protein 175 Calculated Molecular Weight: 504 aa, 56 kDa Observed Molecular Weight: 41-45 kDa, 54-60 kDa GenBank Accession Number: BC005158 Gene Symbol: TMEM175 Gene ID (NCBI): 84286 RRID: AB_10666166 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BSA9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.