Proteintech, 19926-1-AP, ZSCAN5A Polyclonal antibody

Size: 20ul / 150ul The ZSCAN5A (19926-1-AP) by Proteintech is a Polyclonal antibody targeting ZSCAN5A in WB, IHC, ELISA applications with reactivity to human samples 19926-1-AP targets ZSCAN5A in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Zinc finger and SCAN domain-containing protein 5A (ZSCAN5A), also known as ZNF495 or ZSCAN5, belongs to the ZSCAN family of transcription factors. ZSCAN transcription factors contain two major domains, the zinc finger domain and the SCAN box. ZSCAN5A has two isoforms and is predicted to be located in the nucleus, it is also predicted to be involved in the regulation of transcription by RNA polymerase II and may be involved in angiogenesis, cell apoptosis, differentiation, migration and invasion, proliferation (PMID: 31218096). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13898 Product name: Recombinant human ZSCAN5A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 350-496 aa of BC002636 Sequence: AKALPPFACDVCEKRFTCNSKLVIHKRSHTGERLFQCNLCGKRFMQLISLQFHQRTHTGERPYTCDVCQKQFTQKSYLKCHKRSHTGEKPFECKDCKKVFTYRGSLKEHQRIHSGEKPYKCSKCPRAFSRLKLLRRHQKTHPEATSQ Predict reactive species Full Name: zinc finger and SCAN domain containing 5A Calculated Molecular Weight: 496 aa, 56 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC002636 Gene Symbol: ZSCAN5A Gene ID (NCBI): 79149 RRID: AB_2878624 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BUG6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.