Iright
BRAND / VENDOR: Proteintech

Proteintech, 19929-1-AP, HEY1 Polyclonal antibody

CATALOG NUMBER: 19929-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HEY1 (19929-1-AP) by Proteintech is a Polyclonal antibody targeting HEY1 in WB, ELISA applications with reactivity to human, mouse, rat samples 19929-1-AP targets HEY1 in WB, IHC, IF, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, A549 cells, NCI-H1299 cells, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Hairy/enhancer of split-related proteins are basic helix-loop-helix (bHLH) transcription factors implicated in cell fate decision and boundary formation. And HEY1 is one of such protein. It is the direct downstream effector of Notch signaling which may be required for cardiovascular development. It preferentially bind to the canonical E box sequence 5'-CACGTG-3' and acts as a transcriptional repressor. HEY1 is a 33kDa protein and forms dimer by self-associating. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13906 Product name: Recombinant human HEY1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 155-295 aa of BC001873 Sequence: VSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLGSAHPEAPALRAPPSGSLGPVLPVVTSASKLSPPLLSSVASLSAFPFSFGSFHLLSPNALSPSAPTQAANLGKPYR Predict reactive species Full Name: hairy/enhancer-of-split related with YRPW motif 1 Calculated Molecular Weight: 304 aa, 33 kDa Observed Molecular Weight: 32-34 kDa GenBank Accession Number: BC001873 Gene Symbol: HEY1 Gene ID (NCBI): 23462 RRID: AB_10646438 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y5J3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924