Iright
BRAND / VENDOR: Proteintech

Proteintech, 20116-1-AP, NOSTRIN Polyclonal antibody

CATALOG NUMBER: 20116-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NOSTRIN (20116-1-AP) by Proteintech is a Polyclonal antibody targeting NOSTRIN in WB, IHC, IF/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse samples 20116-1-AP targets NOSTRIN in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, mouse heart tissue, human placenta tissue, mouse liver tissue, mouse lung tissue Positive IP detected in: human placenta tissue Positive IHC detected in: human heart tissue, mouse testis tissue, human hepatocirrhosis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse kidney tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information NOSTRIN is classically known as an endothelial cell protein that sequesters eNOS and inhibits NO production. NOSTRIN contains a single polypeptide chain of 506-aa residues of 58 kDa with an N-terminal cdc15 domain and a C-terminal SH3 domain. NOSTRIN mRNA is abundant in highly vascularized tissues such as placenta, kidney, lung, and heart, and NOSTRIN protein is expressed in vascular endothelial cells. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13989 Product name: Recombinant human NOSTRIN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 122-428 aa of BC014189 Sequence: KWENTLENCYQSILELEKERIQLLCNNLNQYSQHISLFGQTLTTCHTQIHCAISKIDIEKDIQAVMEETAILSTENKSEFLLTDYFEEDPNSAMDKERRKSLLKPKLLRLQRDIEKASKDKEGLERMLKTYSSTSSFSDAKSQKDTAALMDENNLKLDLLEANSYKLSSMLAELEQRPQPSHPCSNSIFRWREKEHTHSYVKISRPFLMKRLENIVSKASSGGQSNPGSSTPAPGAAQLSSRLCKALYSFQARQDDELNLEKGDIVIIHEKKEEGWWFGSLNGKKGHFPAAYVEELPSNAGNTATKA Predict reactive species Full Name: nitric oxide synthase trafficker Calculated Molecular Weight: 506 aa, 58 kDa Observed Molecular Weight: 64 kDa GenBank Accession Number: BC014189 Gene Symbol: NOSTRIN Gene ID (NCBI): 115677 RRID: AB_10666167 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IVI9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924